Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parabacteroides distasonis Outer membrane protein beta-barrel domain-containing protein

Product Specifications

Abbreviation

Recombinant Parabacteroides distasonis ERS852380_02305 protein

Gene Name

ERS852380_02305

UniProt

A0A174MNQ6

Expression Region

15-155aa

Organism

Parabacteroides distasonis

Target Sequence

QTQQGQSAVGFNIGYGFDSKNATLGVDYRYCITDAVRLSPSLTYFVKNDNHSTWAIDLNAHYVVKLSEMFGFYPLAGLSLSFWNWDAGHGLSHNETRLGANIGLGGEVYATDNLSIGLEVKYNIIKDFDQAMLGVRVGYSF

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR4M2 activation kit by CRISPRa
GA118164 1 Kit

Human OR4M2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS713939 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
MBD1 Recombinant Rabbit Monoclonal Antibody [PSH01-78]
HA721730 100 µL

MBD1 Recombinant Rabbit Monoclonal Antibody [PSH01-78]

Sign In for Pricing
View Details
MED14 (Center) Rabbit Polyclonal Antibody
AP52649PU-N 400 µL

MED14 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ATG5 (Autophagy Marker) (ATG5/2553), CF488A conjugate, 0.1mg/mL
BNC882553-100 1x 100 µL

ATG5 (Autophagy Marker) (ATG5/2553), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5B1]
CF805353 100 µg

p53 (TP53) Mouse Monoclonal Antibody [Clone ID: OTI5B1]

Sign In for Pricing
View Details