Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Parabacteroides distasonis Outer membrane protein beta-barrel domain-containing protein

Product Specifications

Abbreviation

Recombinant Parabacteroides distasonis ERS852380_02305 protein

Gene Name

ERS852380_02305

UniProt

A0A174MNQ6

Expression Region

15-155aa

Organism

Parabacteroides distasonis

Target Sequence

QTQQGQSAVGFNIGYGFDSKNATLGVDYRYCITDAVRLSPSLTYFVKNDNHSTWAIDLNAHYVVKLSEMFGFYPLAGLSLSFWNWDAGHGLSHNETRLGANIGLGGEVYATDNLSIGLEVKYNIIKDFDQAMLGVRVGYSF

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Bioactivity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A1 / (Hairy Cell Leukemia Marker) (5E4/1), CF488A conjugate, 0.1mg/mL
BNC882325-100 1x 100 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (5E4/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF405S conjugate, 0.1mg/mL
BNC043647-100 1x 100 µL

Spectrin beta III (SPTBN2) (rSPTBN2/1778), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Human CD101 Antibody[BB27]
E-AB-F1361D-01 20 Tests

PE Anti-Human CD101 Antibody[BB27]

Sign In for Pricing
View Details
PE Anti-Human CD101 Antibody[BB27]
E-AB-F1361D-02 100 Tests

PE Anti-Human CD101 Antibody[BB27]

Sign In for Pricing
View Details
PE Anti-Human CD101 Antibody[BB27]
E-AB-F1361D-03 2x 100 Tests

PE Anti-Human CD101 Antibody[BB27]

Sign In for Pricing
View Details
Fluorescein Tyramide
11062-AAT 1 mg

Fluorescein Tyramide

Sign In for Pricing
View Details