Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cholesterol 25-hydroxylase (Ch25h)

Product Specifications

Product Name Alternative

Cholesterol 25-monooxygenase (m25OH)

Abbreviation

Recombinant Mouse Ch25h protein

Gene Name

Ch25h

UniProt

Q9Z0F5

Expression Region

1-298aa

Organism

Mus musculus (Mouse)

Target Sequence

MGCYNGSELQDLGCSSQLLLQPLWDTIRTREAFTRSPIFPVTFSIITYVGFCLPFVVLDVLYPWVPILRRYKIHPDFSPSVKQLLPCLGLTLYQHLVFVFPVTLLHWVRSPALLPQEAPELVQLLSHVLICLLLFDTEIFAWHLLHHKVPWLYRTFHKVHHQNSSSFALATQYMSFWELLSLTFFDVLNVAVLRCHPLTIFTFHVINIWLSVEDHSGYDFPWSTHRLVPFGWYGGVAHHDMHHSQFNCNFAPYFTHWDKMLGTLRSAPLPESLCACGERCVNSRERCAVHLIQKKKQT

Tag

N-terminal 10xHis-tagged

Type

CF Transmembrane Protein & Developed Protein

Source

In vitro E.coli expression system

Field of Research

Cancer

Relevance

Catalyzes the formation of 25-hydroxycholesterol from cholesterol, leading to repress cholesterol biosynthetic enzymes.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

36.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Non-Phospho-Tau (T217) Recombinant Rabbit monoclonal Antibody
HA723846B 100 µL

Non-Phospho-Tau (T217) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E9]
TA501284AM 100 µL

ketohexokinase (KHK) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4E9]

Sign In for Pricing
View Details
FBXO21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C10]
TA503996AM 100 µL

FBXO21 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6C10]

Sign In for Pricing
View Details
Zinc Trifluoroacetate Hydrate
TRC-Z217985-100MG 100 mg

Zinc Trifluoroacetate Hydrate

Sign In for Pricing
View Details
Ccdc88b Mouse Gene Knockout Kit (CRISPR)
KN502760 1 Kit

Ccdc88b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HSD11B2 Polyclonal Antibody
E-AB-13311-01 20 µL

HSD11B2 Polyclonal Antibody

Sign In for Pricing
View Details