Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Plutella xylostella N6-adenosine-methyltransferase subunit METTL14

Product Specifications

Abbreviation

Recombinant Plutella xylostella N6-adenosine-methyltransferase subunit METTL14 protein

UniProt

WQH20074.1

Expression Region

1-377aa

Organism

Plutella xylostella (Diamondback moth) (Plutella maculipennis)

Target Sequence

MSEKLKELRERSQKRKKLLAQTLGVSSVSELRHALGASLDVPAKKQAAAEGGPDDDKPAAKDQPDELVYTDSSTFLKGTQSSNPHNDYCQHFVDTGQRPQNFIRDVGLADRFEEYPKLRELIKLKDDLIAETATPPMYLKCDLKTFDLKELNNKFDVLLVEPPLGGAWRWRDVLDLELQQLAQPRAFVFLWCGSSDGLDMGRECLKKWGFRRCEDICWIKTNINNPGHSKNLEQNAVFQRTKEHCLMGIKGTVRRSVDGDFIHANVDIDLIISEDAEFGSAEKPIEIFHIMEHFCLGRRRIHLFGRDSTIRPGWVTLGHELTNSNFNASLYASYFLGGRSHTGCTERIEALRPKSPPAAGKTRPRRPGFRPRPRTNV

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL
BNC472216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-100 1x 100 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-500 1x 500 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL
BNC941050-500 1x 500 µL

CD3e (CRIS-7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details