Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Folate receptor alpha (FOLR1), partial

Product Specifications

Product Name Alternative

FR-alpha; Adult folate-binding protein; FBP; Folate receptor 1; Folate receptor, adult; KB cells FBP; Ovarian tumor-associated antigen MOv18

Abbreviation

Recombinant Human FOLR1 protein, partial

Gene Name

FOLR1

UniProt

P15328

Expression Region

25-233aa

Organism

Homo sapiens (Human)

Target Sequence

RIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAM

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Tags & Cell Markers

Relevance

Binds to folate and reduced folic acid derivatives and mediates delivery of 5-methyltetrahydrofolate and folate analogs into the interior of cells. Has high affinity for folate and folic acid analogs at neutral pH. Exposure to slightly acidic pH after receptor endocytosis triggers a conformation change that strongly reduces its affinity for folates and mediates their release. Required for normal embryonic development and normal cell proliferation.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT3 Rabbit Polyclonal Antibody
TA368346 100 µL

FUT3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ciao1 Mouse Gene Knockout Kit (CRISPR)
KN503340 1 Kit

Ciao1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FLI1 Antibody
8C0196-AAT 50 µg

FLI1 Antibody

Sign In for Pricing
View Details
1,3-Propylene-d6 Thiourea
TRC-T311372-1MG 1 mg

1,3-Propylene-d6 Thiourea

Sign In for Pricing
View Details
Dbil5 (NM_021294) Mouse Tagged ORF Clone
MG200199 10 µg

Dbil5 (NM_021294) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human ZNF707 activation kit by CRISPRa
GA117273 1 Kit

Human ZNF707 activation kit by CRISPRa

Sign In for Pricing
View Details