Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gastric inhibitory polypeptide receptor (Gipr), partial

Product Specifications

Product Name Alternative

GIP-R; Glucose-dependent insulinotropic polypeptide receptor

Abbreviation

Recombinant Rat Gipr protein, partial

Gene Name

Gipr

UniProt

P43219

Expression Region

19-135aa

Organism

Rattus norvegicus (Rat)

Target Sequence

RAETDSEGQTTGELYQRWERYGWECQNTLEATEPPSGLACNGSFDMYACWNYTAANTTARVSCPWYLPWYRQVAAGFVFRQCGSDGQWGSWRDHTQCENPEKNGAFQDQKLILERLQ

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Obesity

Relevance

This is a receptor for GIP. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GBP5 Antibody (OTI5C9) [DyLight 755]
NBP2-72343IR 0.1 mL

Mouse Monoclonal GBP5 Antibody (OTI5C9) [DyLight 755]

Sign In for Pricing
View Details
Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit
MBS9335818-01 48 Well

Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit

Sign In for Pricing
View Details
Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit
MBS9335818-02 96 Well

Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit

Sign In for Pricing
View Details
Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit
MBS9335818-03 5x 96 Well

Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit

Sign In for Pricing
View Details
Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit
MBS9335818-04 10x 96 Well

Human Keratin-associated protein 9-3, KRTAP9-3 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Mvk shRNA (UAS) - Lentiviral mouse Mvk shRNA (UAS) (100)
GTR15254910 1 Vial

Lentiviral mouse Mvk shRNA (UAS) - Lentiviral mouse Mvk shRNA (UAS) (100)

Sign In for Pricing
View Details