Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 13 (TNFSF13) (Active)

Product Specifications

Product Name Alternative

Tumor necrosis factor ligand superfamily member 13; A proliferation-inducing ligand (APRIL) ; TNF- and APOL-related leukocyte expressed ligand 2 (TALL-2) ; TNF-related death ligand 1 (TRDL-1) ; CD256; TNFSF13; APRIL, TALL2, ZTNF2; UNQ383/PRO715

Abbreviation

Recombinant Human TNFSF13 protein (Active)

Gene Name

TNFSF13

UniProt

O75888-1

Expression Region

105-250aa

Organism

Homo sapiens (Human)

Target Sequence

AVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL

Tag

N-terminal hFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Human TNFSF13 protein at 2 μg/mL can bind Human TNFRSF17 protein (CSB-MP023974HU1-B) . The EC50 is 0.8083-0.9391 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B protein (CSB-MP6427MOV) at 2 μg/mL can bind Human TNFSF13 protein. The EC50 is 11.13-18.97 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.6 kDa

References & Citations

M2 macrophage-derived paracrine factor TNFSF13 affects the fibrogenic alterations in endothelial cells and cardiac fibroblasts by mediating the NF-kappaB and Akt pathway. Tan X., Wang J., Liu X., Xie G., Ouyang F. J Biochem Mol Toxicol 38:e23707-e23707 (2024)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein of Isoform Alpha

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP54 Antibody
A35632-100UG 100 µg

SRP54 Antibody

Sign In for Pricing
View Details
Collagen VI alpha 3 Blocking Peptide
MBS9622425-01 1 mg

Collagen VI alpha 3 Blocking Peptide

Sign In for Pricing
View Details
Collagen VI alpha 3 Blocking Peptide
MBS9622425-02 5x 1 mg

Collagen VI alpha 3 Blocking Peptide

Sign In for Pricing
View Details
Mesdc1 Rat shRNA Plasmid (Locus ID 308795)
TL701892 1 Kit

Mesdc1 Rat shRNA Plasmid (Locus ID 308795)

Sign In for Pricing
View Details
S1PR3 sgRNA CRISPR Lentivector set (Human)
K2081601 3x 1.0 µg

S1PR3 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Ank3 Rat shRNA Lentiviral Particle (Locus ID 361833)
TL703264V 500 µL Each

Ank3 Rat shRNA Lentiviral Particle (Locus ID 361833)

Sign In for Pricing
View Details