Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-1 receptor accessory protein-like 1 (IL1RAPL1), partial (Active)

Product Specifications

Product Name Alternative

Interleukin-1 receptor accessory protein-like 1; EC:3.2.2.6; IL-1-RAPL-1; IL-1RAPL-1; IL1RAPL-1; Oligophrenin-4; Three immunoglobulin domain-containing IL-1 receptor-related 2 (TIGIRR-2) ; X-linked interleukin-1 receptor accessory protein-like 1; IL1RAPL1; OPHN4

Abbreviation

Recombinant Human IL1RAPL1 protein, partial (Active)

Gene Name

IL1RAPL1

UniProt

Q9NZN1

Expression Region

19-357aa

Organism

Homo sapiens (Human)

Target Sequence

LKVVTKRGSADGCTDWSIDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKRELMYT

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

May regulate secretion and presynaptic differentiation through inhibition of the activity of N-type voltage-gated calcium channel. May activate the MAP kinase JNK. Plays a role in neurite outgrowth. During dendritic spine formation can bidirectionally induce pre- and post-synaptic differentiation of neurons by trans-synaptically binding to PTPRD.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human PTPRD protein (CSB-MP019051HU (A4) ) at 2 μg/mL can bind Human IL1RAPL1 protein. The EC50 is 2.645-3.098 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

66.4 kDa

References & Citations

A truncating mutation in the IL1RAPL1 gene is responsible for X-linked mental retardation in the MRX21 family. Tabolacci E., Pomponi M.G., Pietrobono R., Terracciano A., Chiurazzi P., Neri G. Am. J. Med. Genet. A 140:482-487 (2006)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCB (PC) (886-899) Goat Polyclonal Antibody
AP08821PU-N 50 µg

PCB (PC) (886-899) Goat Polyclonal Antibody

Sign In for Pricing
View Details
FAM123C (AMER3) Human qPCR Primer Pair (NM_001105194)
HP227541 200 Reactions

FAM123C (AMER3) Human qPCR Primer Pair (NM_001105194)

Sign In for Pricing
View Details
ANKRD13B (NM_152345) Human Recombinant Protein
TP307669 20 µg

ANKRD13B (NM_152345) Human Recombinant Protein

Sign In for Pricing
View Details
CNKSR1 Human Gene Knockout Kit (CRISPR)
KN423509 1 Kit

CNKSR1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF640R conjugate, 0.1mg/mL
BNC401167-100 1x 100 µL

Cytokeratin 7 (KRT7/760 + OV-TL12/30), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Calm1 activation kit by CRISPRa
GA200497 1 Kit

Mouse Calm1 activation kit by CRISPRa

Sign In for Pricing
View Details