Recombinant Human Tumor necrosis factor receptor superfamily member 3 (LTBR), partial (Active)

Tumor necrosis factor receptor superfamily member 3; Lymphotoxin-beta receptor; Tumor necrosis factor C receptor; Tumor necrosis factor receptor 2-related protein; Tumor necrosis factor receptor type III (TNF-RIII; TNFR-III) ; LTBR; D12S370, TNFCR, TNFR3, TNFRSF3

QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLM

Receptor for the heterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. Activates NF-kappa-B signaling pathway upon stimulation with lymphotoxin (LTA1-LTB2) . Promotes apoptosis via TRAF3 and TRAF5. May play a role in the development of lymphoid organs

Measured by its binding ability in a functional ELISA. Immobilized Human LTBR at 2 μg/mL can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B) . The EC50 is 4.282-4.919 ng/mL.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Complete sequencing and characterization of 21,243 full-length human cDNAs. Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Sugano S. Nat. Genet. 36:40-45 (2004)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.