Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Lymphotoxin beta receptor (LTBR), partial (Active)

Product Specifications

Product Name Alternative

Lymphotoxin beta receptor; LTBR

Abbreviation

Recombinant Cynomolgus monkey LTBR protein, partial (Active)

Gene Name

LTBR

UniProt

A0A2K5VGQ6

Expression Region

28-229aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

SQPQVVRKGPVPPYGSENQTCRDQEKEYYEPRHRICCSRCPPGTYVSAKCSRSRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCEDQGLVEAAPGTAQSDTTCRNPSESLPPEMSGT

Tag

C-terminal hFc1-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cell Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Cynomolgus LTBR at 2 μg/mL can bind Biotinylated human TNFSF14 (CSB-MP023991HUj7-B) . The EC50 is 4.316-4.875 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51.2 kDa

References & Citations

Warren W., Wilson R.K. Submitted to EMBL/GenBank/DDBJ databases (MAR-2013)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rifamycin AF-K28259
GW8320-10mg 10 mg

Rifamycin AF-K28259

Sign In for Pricing
View Details
DiagSupport™ Fmoc-D-Arg (Pbf) -Wang PEG-Polystyrene Resin, 90 µm, 0.16-0.25 mmol/g
SPS-RA23-211 1 g

DiagSupport™ Fmoc-D-Arg (Pbf) -Wang PEG-Polystyrene Resin, 90 µm, 0.16-0.25 mmol/g

Sign In for Pricing
View Details
GFP hsa-miR-126-5p AAV miRNA Vector
Amh1157300 500 ng

GFP hsa-miR-126-5p AAV miRNA Vector

Sign In for Pricing
View Details
Lentiviral human SLC51A shRNA (UAS) - Lentiviral human SLC51A shRNA (UAS, iRFP) plasmid
GTR15118372 1 Vial

Lentiviral human SLC51A shRNA (UAS) - Lentiviral human SLC51A shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Potassium Permanganate 0.02M (0.1N) Standardized Solution Traceable to NIST
VS082 01000 1 L

Potassium Permanganate 0.02M (0.1N) Standardized Solution Traceable to NIST

Sign In for Pricing
View Details
Rabbit Anti-TICN1/SPOCK1 Polyclonal Antibody
PAV4026 100 μL

Rabbit Anti-TICN1/SPOCK1 Polyclonal Antibody

Sign In for Pricing
View Details