Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Endothelin-1 receptor (EDNRA) -VLPs (Active)

Product Specifications

Product Name Alternative

Endothelin-1 receptor; Endothelin receptor type A; EDNRA; ETA, ETRA

Abbreviation

Recombinant Human EDNRA protein-VLPs (Active)

Gene Name

EDNRA

UniProt

P25101

Expression Region

21-427aa

Organism

Homo sapiens (Human)

Target Sequence

DNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSMN

Tag

C-terminal 10xHis-tagged

Type

MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

The purity information is not available for VLPs proteins.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human EDNRA at 10 μg/mL can bind Anti-EDNRA recombinant antibody (CSB-RA007403MA3HU) . The EC50 is 2.225-3.570 ng/mL. The VLPs (CSB-MP3838) is negative control.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 0.2 M Arginine, 6% Trehalose

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

47.9 kDa

References & Citations

Mutations in the endothelin receptor type A cause mandibulofacial dysostosis with alopecia. Gordon C.T., Weaver K.N., Zechi-Ceide R.M., Madsen E.C., Tavares A.L., Oufadem M., Kurihara Y., Adameyko I., Picard A., Amiel J. Am. J. Hum. Genet. 96:519-531 (2015)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human LGALSL Protein (His Tag)
PKSH032477-01 10 µg

Recombinant Human LGALSL Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human LGALSL Protein (His Tag)
PKSH032477-02 50 µg

Recombinant Human LGALSL Protein (His Tag)

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109T-01 20 Tests

Elab Fluor® Violet 610 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109T-02 100 Tests

Elab Fluor® Violet 610 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
Elab Fluor® Violet 610 Anti-Human CD4 Antibody[RPA-T4]
E-AB-F1109T-03 2x 100 Tests

Elab Fluor® Violet 610 Anti-Human CD4 Antibody[RPA-T4]

Sign In for Pricing
View Details
rac Salsolinol, Hydrobromide
TRC-S099995-10MG 10 mg

rac Salsolinol, Hydrobromide

Sign In for Pricing
View Details