Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Claudin-6 (Cldn6) -VLPs (Active)

Product Specifications

Product Name Alternative

Claudin-6; Skullin; Cldn6

Abbreviation

Recombinant Mouse Cldn6 protein-VLPs (Active)

Gene Name

Cldn6

UniProt

Q9Z262

Expression Region

1-219aa

Organism

Mus musculus (Mouse)

Target Sequence

MASTGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQMVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVVTLLIVLLGLLVYLAGAKCTTCVEDRNSKSRLVLISGIIFVISGVLTLIPVCWTAHSIIQDFYNPLVADAQKRELGASLYLGWAASGLLLLGGGLLCCACSSGGTQGPRHYMACYSTSVPHSRGPSEYPTKNYV

Tag

C-terminal 10xHis-tagged (This tag can be tested only under denaturing conditions)

Type

MP-VLP Transmembrane Protein & Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SEC-HPLC.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA1HU) . The EC50 is 4.027-6.270 ng/mL.The VLPs (CSB-MP3838) is negative control. ②Measured by its binding ability in a functional ELISA. Immobilized Mouse cldn6 at 5 μg/mL can bind Anti-CLDN6/9 recombinant antibody (CSB-RA005508MA3HU) . The EC50 is 7.349-12.12 ng/mL.The VLPs (CSB-MP3838) is negative control.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

24.8 kDa

References & Citations

The transcriptional landscape of the mammalian genome. Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Hayashizaki Y. Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pigeon Hemoglobin subunit beta (HBB) ELISA Kit
MBS283407-01 48 Tests

Pigeon Hemoglobin subunit beta (HBB) ELISA Kit

Sign In for Pricing
View Details
Pigeon Hemoglobin subunit beta (HBB) ELISA Kit
MBS283407-02 96 Tests

Pigeon Hemoglobin subunit beta (HBB) ELISA Kit

Sign In for Pricing
View Details
Pigeon Hemoglobin subunit beta (HBB) ELISA Kit
MBS283407-03 5x 96 Tests

Pigeon Hemoglobin subunit beta (HBB) ELISA Kit

Sign In for Pricing
View Details
Pigeon Hemoglobin subunit beta (HBB) ELISA Kit
MBS283407-04 10x 96 Tests

Pigeon Hemoglobin subunit beta (HBB) ELISA Kit

Sign In for Pricing
View Details
Sheep anti human tPA IgG fraction, FITC labeled
MBS135280-01 1 mg

Sheep anti human tPA IgG fraction, FITC labeled

Sign In for Pricing
View Details
Sheep anti human tPA IgG fraction, FITC labeled
MBS135280-02 10 mg

Sheep anti human tPA IgG fraction, FITC labeled

Sign In for Pricing
View Details