Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Killer cell lectin-like receptor subfamily G member 1 (Klrg1), partial, Biotinylated

Product Specifications

Product Name Alternative

Mast cell function-associated antigen 2F1

Abbreviation

Recombinant Mouse Klrg1 protein, partial, Biotinylated

Gene Name

Klrg1

UniProt

O88713

Expression Region

57-188aa

Organism

Mus musculus (Mouse)

Target Sequence

QRILCCGSKDSTCSHCPSCPILWTRNGSHCYYFSMEKKDWNSSLKFCADKGSHLLTFPDNQGVKLFGEYLGQDFYWIGLRNIDGWRWEGGPALSLRILTNSLIQRCGAIHRNGLQASSCEVALQWICKKVLY

Tag

C-terminal hFc1-Avi-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Plays an inhibitory role on natural killer (NK) cells and T-cell functions upon binding to their non-MHC ligands. May mediate missing self recognition by binding to a highly conserved site on classical cadherins, enabling it to monitor expression of E-cadherin/CDH1, N-cadherin/CDH2 and R-cadherin/CDH4 on target cells.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

45.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Proteasome Subunit Alpha Type 1 ELISA Kit
MBS050057-01 48 Well

Bovine Proteasome Subunit Alpha Type 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Proteasome Subunit Alpha Type 1 ELISA Kit
MBS050057-02 96 Well

Bovine Proteasome Subunit Alpha Type 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Proteasome Subunit Alpha Type 1 ELISA Kit
MBS050057-03 5x 96 Well

Bovine Proteasome Subunit Alpha Type 1 ELISA Kit

Sign In for Pricing
View Details
Bovine Proteasome Subunit Alpha Type 1 ELISA Kit
MBS050057-04 10x 96 Well

Bovine Proteasome Subunit Alpha Type 1 ELISA Kit

Sign In for Pricing
View Details
NADPH Concentrate, 300UL
X044-300UL 300UL

NADPH Concentrate, 300UL

Sign In for Pricing
View Details
Early Activation Antigen CD69 (CD69) Antibody (PerCP)
abx139321 100 Tests

Early Activation Antigen CD69 (CD69) Antibody (PerCP)

Sign In for Pricing
View Details