Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Inactive tyrosine-protein kinase transmembrane receptor ROR1 (Ror1), partial (Active)

Product Specifications

Product Name Alternative

Inactive tyrosine-protein kinase transmembrane receptor ROR1; mROR1; Neurotrophic tyrosine kinase, receptor-related 1; Ror1; Ntrkr1

Abbreviation

Recombinant Mouse Ror1 protein, partial (Active)

Gene Name

Ror1

UniProt

Q9Z139

Expression Region

30-403aa

Organism

Mus musculus (Mouse)

Target Sequence

QETELSVSAELVPTSSWNTSSEIDKGSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPSIRWFKNDAPVVQEPRRISFRATNYGSRLRIRNLDTTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEVLENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHSFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Neuroscience

Relevance

Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo. Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling. In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells. Via IGFBP5 ligand, forms a complex with ERBB2 to enhance CREB oncogenic signaling.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Ror1 at 2 μg/mL can bind Anti-ROR1 recombinant antibody (CSB-RA020067MA2HU) . The EC50 is 0.8551-0.9363 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.6 kDa

References & Citations

The transcriptional landscape of the mammalian genome. Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Hayashizaki Y. Science 309:1559-1563 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)
MBS1237403-01 0.02 mg (E-Coli)

Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)
MBS1237403-02 0.1 mg (E-Coli)

Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)
MBS1237403-03 0.02 mg (Yeast)

Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)
MBS1237403-04 0.1 mg (Yeast)

Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)
MBS1237403-05 0.02 mg (Baculovirus)

Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)

Sign In for Pricing
View Details
Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)
MBS1237403-06 0.02 mg (Mammalian-Cell)

Recombinant Anaeromyxobacter sp. Ribonuclease H (rnhA)

Sign In for Pricing
View Details