Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Insulin-like growth factor 2 (IGF2)

Product Specifications

Product Name Alternative

IGF-II; Erythrotropin

Abbreviation

Recombinant Bovine IGF2 protein

Gene Name

IGF2

UniProt

P07456

Expression Region

25-91aa

Organism

Bos taurus (Bovine)

Target Sequence

AYRPSETLCGGELVDTLQFVCGDRGFYFSRPSSRINRRSRGIVEECCFRSCDLALLETYCATPAKSE

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF2 is influenced by placental lactogen. Also involved in tissue differentiation. In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver. Acts as a ligand for integrin which is required for IGF2 signaling. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation. Inhibits myoblast differentiation and modulates metabolism via increasing the mitochondrial respiration rate. ; Preptin undergoes glucose-mediated co-secretion with insulin, and acts as physiological amplifier of glucose-mediated insulin secretion. Exhibits osteogenic properties by increasing osteoblast mitogenic activity through phosphoactivation of MAPK1 and MAPK3.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tapentadol Impurity A phosphate
CS-DE-01710 1 Each

Tapentadol Impurity A phosphate

Sign In for Pricing
View Details
Pcsk2 (NM_008792) Mouse Tagged Lenti ORF Clone
MR226625L4 10 µg

Pcsk2 (NM_008792) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD54 Antibody (Low Endotoxin)
GWB-FBC46A 0.5 mg

CD54 Antibody (Low Endotoxin)

Sign In for Pricing
View Details
CDKL2 Protein Vector (Mouse) (pPB-N-His)
PV164199 500 ng

CDKL2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Thyroid peroxidase Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-10406R-BF680-01 20 µL

Thyroid peroxidase Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Thyroid peroxidase Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-10406R-BF680-02 100 µL

Thyroid peroxidase Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details