Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial

Product Specifications

Product Name Alternative

Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2; TRAIL receptor 2; TRAIL-R2; CD antigen CD262

Abbreviation

Recombinant Human TNFRSF10B protein, partial

Gene Name

TNFRSF10B

UniProt

O14763

Expression Region

56-182aa

Organism

Homo sapiens (Human)

Target Sequence

ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

41.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-500 1x 500 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL
BNC740266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-500 1x 500 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF594 conjugate, 0.1mg/mL
BNC941992-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF647 conjugate, 0.1mg/mL
BNC471788-500 1x 500 µL

B7-H4 (Immuno-Inhibitory Protein) (B7H4/1788), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL
BNC680334-100 1x 100 µL

Cytokeratin 8 (H1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details