Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Glucagon receptor (Gcgr), partial (Active)

Product Specifications

Product Name Alternative

Glucagon receptor; GL-R; Gcgr

Abbreviation

Recombinant Rat Gcgr protein, partial (Active)

Gene Name

Gcgr

UniProt

P30082

Expression Region

27-137aa

Organism

Rattus norvegicus (Rat)

Target Sequence

AQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQSWRDASQCQMDDDEIEVQKGVAK

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

G-protein coupled receptor for glucagon that plays a central role in the regulation of blood glucose levels and glucose homeostasis. Regulates the rate of hepatic glucose production by promoting glycogen hydrolysis and gluconeogenesis. Plays an important role in mediating the responses to fasting. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Promotes activation of adenylate cyclase. Besides, plays a role in signaling via a phosphatidylinositol-calcium second messenger system.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Rat Gcgr at 2 μg/mL can bind Anti-Gcgr recombinant antibody (CSB-RA009316MA1HU) . The EC50 is 29.63-35.34 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.4 kDa

References & Citations

Quantitative maps of protein phosphorylation sites across 14 different rat organs and tissues. Lundby A., Secher A., Lage K., Nordsborg N.B., Dmytriyev A., Lundby C., Olsen J.V. Nat. Commun. 3:876-876 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABA A Receptor alpha 6 (GABRA6) Human siRNA Oligo Duplex (Locus ID 2559)
SR320238 1 Kit

GABA A Receptor alpha 6 (GABRA6) Human siRNA Oligo Duplex (Locus ID 2559)

Sign In for Pricing
View Details
ABTB2 Protein Vector (Rat) (pPM-C-HA)
PV251652 500 ng

ABTB2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
DIRA1 Antibody
8C16016-AAT 50 µg

DIRA1 Antibody

Sign In for Pricing
View Details
Tert-Butyl (3S,5S) -3-amino-5-fluoropiperidine-1-carboxylate
HCD05672-01 0.25 g

Tert-Butyl (3S,5S) -3-amino-5-fluoropiperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl (3S,5S) -3-amino-5-fluoropiperidine-1-carboxylate
HCD05672-02 0.5 g

Tert-Butyl (3S,5S) -3-amino-5-fluoropiperidine-1-carboxylate

Sign In for Pricing
View Details
Tert-Butyl (3S,5S) -3-amino-5-fluoropiperidine-1-carboxylate
HCD05672-03 1 g

Tert-Butyl (3S,5S) -3-amino-5-fluoropiperidine-1-carboxylate

Sign In for Pricing
View Details