Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Angiopoietin-1 (ANGPT1), partial

Product Specifications

Product Name Alternative

ANG-1

Abbreviation

Recombinant Human ANGPT1 protein, partial

Gene Name

ANGPT1

UniProt

Q15389

Expression Region

277-498aa

Organism

Homo sapiens (Human)

Target Sequence

REEEKPFRDCADVYQAGFNKSGIYTIYINNMPEPKKVFCNMDVNGGGWTVIQHREDGSLDFQRGWKEYKMGFGNPSGEYWLGNEFIFAITSQRQYMLRIELMDWEGNRAYSQYDRFHIGNEKQNYRLYLKGHTGTAGKQSSLILHGADFSTKDADNDNCMCKCALMLTGGWWFDACGPSNLNGMFYTAGQNHGKLNGIKWHYFKGPSYSLRSTTMMIRPLDF

Tag

N-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cardiovascular

Relevance

Binds and activates TEK/TIE2 receptor by inducing its dimerization and tyrosine phosphorylation. Plays an important role in the regulation of angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Required for normal angiogenesis and heart development during embryogenesis. After birth, activates or inhibits angiogenesis, depending on the context. Inhibits angiogenesis and promotes vascular stability in quiescent vessels, where endothelial cells have tight contacts. In quiescent vessels, ANGPT1 oligomers recruit TEK to cell-cell contacts, forming complexes with TEK molecules from adjoining cells, and this leads to preferential activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascades. In migrating endothelial cells that lack cell-cell adhesions, ANGT1 recruits TEK to contacts with the extracellular matrix, leading to the formation of focal adhesion complexes, activation of PTK2/FAK and of the downstream kinases MAPK1/ERK2 and MAPK3/ERK1, and ultimately to the stimulation of sprouting angiogenesis. Mediates blood vessel maturation/stability. Implicated in endothelial developmental processes later and distinct from that of VEGF. Appears to play a crucial role in mediating reciprocal interactions between the endothelium and surrounding matrix and mesenchyme.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

29.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (TFRC/1059), 0.2mg/mL
BNUB1059-500 1x 500 µL

CD71 (TFRC/1059), 0.2mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), 0.2mg/mL
BNUB0177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), 0.2mg/mL

Sign In for Pricing
View Details
1-Desoxycarbadox
TRC-D296999-10MG 10 mg

1-Desoxycarbadox

Sign In for Pricing
View Details
syn-2-Pyridinealdoxime
TRC-P991290-5G 5 g

syn-2-Pyridinealdoxime

Sign In for Pricing
View Details
PKNOX2 Antibody
8C11510-AAT 50 µg

PKNOX2 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Thyroid gland
CS635496 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details