Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Programmed Cell Death Protein 1 precursor, partial, Biotinylated

Product Specifications

Abbreviation

Recombinant Dog Programmed Cell Death protein 1 precursor protein, partial, Biotinylated

UniProt

NP_001301026

Expression Region

25-168aa

Organism

Canis lupus familiaris (Dog) (Canis familiaris)

Target Sequence

LDSPDRPWSPLTFSPAQLTVQEGENATFTCSLADIPDSFVLNWYRLSPRNQTDKLAAFQEDRIEPGRDRRFRVTRLPNGRDFHMSIVAARLNDSGIYLCGAIYLPPNTQINESPRAELSVTERTLEPPTQSPSPPPRLSGQLQG

Tag

C-terminal hFc1-Avi-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

44.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Corin (CRN) ELISA Kit
RDR-CRN-Hu-01 96 Tests

Human Corin (CRN) ELISA Kit

Sign In for Pricing
View Details
Human Corin (CRN) ELISA Kit
RDR-CRN-Hu-02 48 Tests

Human Corin (CRN) ELISA Kit

Sign In for Pricing
View Details
2’-Hydroxy-5’-nitrohexadecanamide Sodium Salt
TRC-H949200-1G 1 g

2’-Hydroxy-5’-nitrohexadecanamide Sodium Salt

Sign In for Pricing
View Details
4-Nitrophenylglyoxylic Acid
TRC-N232260-500MG 500 mg

4-Nitrophenylglyoxylic Acid

Sign In for Pricing
View Details
HELT Polyclonal Antibody
E-AB-18075-01 20 µL

HELT Polyclonal Antibody

Sign In for Pricing
View Details
HELT Polyclonal Antibody
E-AB-18075-02 60 µL

HELT Polyclonal Antibody

Sign In for Pricing
View Details