Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PBMUCL2 (HCG22)

Product Specifications

Product Name Alternative

HLA complex group 22; Panbronchiolitis-related mucin-like protein 2

Abbreviation

Recombinant Human HCG22 protein

Gene Name

HCG22

UniProt

E2RYF7

Expression Region

23-251aa

Organism

Homo sapiens (Human)

Target Sequence

VNFGEKDAKVPGTWRDGVRVPGEGASWDSDRASPERRYGIVGLSQSISTKHPETSPKDSRIRENDVTADGRTTEDHITADPGTTEDSVTADPGTTEDNVTVDPGTTEGSVTADPATTKDYVSADPGTTKDSVTADPGTTENFVTADPGTTKDSITADPRTTEDSVTADPGTTKHSITVDPGTTEDSVTADPGTTKHSITADPGTTEDSVTADPGTTEDETTKHGDTHLL

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroglobulin (2H11), CF647 conjugate, 0.1mg/mL
BNC470023-500 1x 500 µL

Thyroglobulin (2H11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Simtuzumab Biosimilar - Research Grade
ICH5068-50mg 50 mg

Simtuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
PCT Polyclonal Antibody
E-AB-40536-01 25 µL

PCT Polyclonal Antibody

Sign In for Pricing
View Details
PCT Polyclonal Antibody
E-AB-40536-02 100 µL

PCT Polyclonal Antibody

Sign In for Pricing
View Details
Ethylene Terephthalate Cyclic Hexamer
TRC-E918180-2.5MG 2.5 mg

Ethylene Terephthalate Cyclic Hexamer

Sign In for Pricing
View Details
Human LBH activation kit by CRISPRa
GA113084 1 Kit

Human LBH activation kit by CRISPRa

Sign In for Pricing
View Details