Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis MHC class I polypeptide-related sequence B (MICB), partial

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey MICB protein, partial

Gene Name

MICB

UniProt

UJY53393.1

Expression Region

31-297aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

ELHSLRYNVTVLSRDGSVQSGFLAEGHLDGQLFVRYDRETRRARPQGQWAEAVLGDQETEDLTENAQDLRRTLTHIEGQKGGLHSLQKIKICEIYEDGSTGGFWHFYYDGELFLSLNLETQKWTVAQSSRAQTLAMSFWKEDTMKTNTHYRAMRADCLKKLRRYQKSRVAVRRTVPPMVNVTHGEASEGNITVTCRASGFYPGNITLTWRQDGVSLSHDAQQWGDVLPDRNGTYYTWVATRIRQGEEQKFACYMEHSGNHSTHPVPS

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

32.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GULP1, Recombinant, Human, aa1-304, His-Tag (PTB Domain-containing Engulfment Adapter Protein 1, CED-6, CED6, GULP)
137072-01 100 µg

GULP1, Recombinant, Human, aa1-304, His-Tag (PTB Domain-containing Engulfment Adapter Protein 1, CED-6, CED6, GULP)

Sign In for Pricing
View Details
GULP1, Recombinant, Human, aa1-304, His-Tag (PTB Domain-containing Engulfment Adapter Protein 1, CED-6, CED6, GULP)
137072-02 500 µg

GULP1, Recombinant, Human, aa1-304, His-Tag (PTB Domain-containing Engulfment Adapter Protein 1, CED-6, CED6, GULP)

Sign In for Pricing
View Details
TRNAP25P sgRNA CRISPR Lentivector (Human) (Target 3)
K2512504 1.0 µg DNA

TRNAP25P sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GUCA1A Protein Vector (Rat) (pPM-C-HA)
PV272016 500 ng

GUCA1A Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NAPSA Antibody
orb1315357-01 30 µL

NAPSA Antibody

Sign In for Pricing
View Details
NAPSA Antibody
orb1315357-02 50 μL

NAPSA Antibody

Sign In for Pricing
View Details