Recombinant Macaca fascicularis Natural cytotoxicity triggering receptor 3 (NCR3), partial (Active)
Product Specifications
Product Name Alternative
Natural cytotoxicity triggering receptor 3; Natural killer cell p30-related protein (NK-p30; NKp30) ; CD337; NCR3
Abbreviation
Recombinant Cynomolgus monkey NCR3 protein, partial (Active)
Gene Name
NCR3
UniProt
P61483
Expression Region
19-135aa
Organism
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Target Sequence
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVAPGKEVRNGTPEFRGRLAPLSSSRFLRDHQAELHIWDVRGHDAGIYVCRVEVLGLGVGTGNGTRLVVEKEYPQLG
Tag
C-terminal 10xHis-tagged
Type
Active Protein & In Stock Protein
Source
Mammalian cell
Field of Research
Immunology
Relevance
Cell membrane receptor of natural killer/NK cells that is activated by binding of extracellular ligands including BAG6 and NCR3LG1. Stimulates NK cells cytotoxicity toward neighboring cells producing these ligands. It controls, for instance, NK cells cytotoxicity against tumor cells. Engagement of NCR3 by BAG6 also promotes myeloid dendritic cells (DC) maturation, both through killing DCs that did not acquire a mature phenotype, and inducing the release by NK cells of TNFA and IFNG that promote DC maturation.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Yes
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis NCR3 at 2 μg/mL on an Nickel Coated plate can bind Macaca fascicularis NCR3LG1 (CSB-MP4942MOVd9) . The EC50 is 7.429 to 11.19 ng/mL.
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Molecular Weight
14.5 kDa
References & Citations
Identification, molecular cloning and functional characterization of NKp46 and NKp30 natural cytotoxicity receptors in Macaca fascicularis NK cells. De Maria A., Biassoni R., Fogli M., Rizzi M., Cantoni C., Costa P., Conte R., Mavilio D., Ensoli B., Moretta L. Eur. J. Immunol. 31:3546-3556 (2001)
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Protein Length
Partial
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940204-100 1x 100 µL
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402848-500 1x 500 µL
Fibronectin (Fn-3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 