Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Tissue factor (F3), partial (Active)

Product Specifications

Product Name Alternative

Tissue factor; Coagulation factor III; F3

Abbreviation

Recombinant Cynomolgus monkey F3 protein, partial (Active)

Gene Name

F3

UniProt

A0A2K5VX02

Expression Region

33-252aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPINQVYTVQISTKSGDWKSKCFYTADTECDLTDEIVKDVKQTYLARVFSYPAGHVESTGSTEEPPYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVQDEWTLVRRNDTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRRTANRKSTDSPVECMGHEKGESRE

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis F3 at 2 μg/mL can bind Anti-F3 recombinant antibody (CSB-RA007928MA2HU) . The EC50 is 0.4495-0.5538 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.4 kDa

References & Citations

/

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGSF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1071308 1.0 µg DNA

IGSF1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rat Hmga2 Pre-designed siRNA Set A
SI206285A 1 Each

Rat Hmga2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Goat anti Human IgA (FITC)
60-S1104GA01-AF 10 ml

Goat anti Human IgA (FITC)

Sign In for Pricing
View Details
GATA3 Polyclonal Antibody, PerCP Conjugated
bs-23118R-PerCP 100 µL

GATA3 Polyclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Lentiviral human MRPL37 shRNA (UAS) - Lentiviral human MRPL37 shRNA (UAS, RFP) (100)
GTR15351699 1 Vial

Lentiviral human MRPL37 shRNA (UAS) - Lentiviral human MRPL37 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Human RPGRIP1L Protein, N-His
AP94261 50 µg

Recombinant Human RPGRIP1L Protein, N-His

Sign In for Pricing
View Details