Recombinant Human Tumor necrosis factor receptor superfamily member 25 (TNFRSF25), partial (Active)

Tumor necrosis factor receptor superfamily member 25; Apo-3; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apoptosis-mediating receptor TRAMP; Death receptor 3; TNFRSF25; APO3, DDR3, DR3, TNFRSF12, WSL, WSL1; UNQ455/PRO779

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQ

Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.

①Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Anti-TNFRSF25 recombinant antibody (CSB-RA839000MA2HU) . The EC50 is 4.485-5.277 ng/mL. ②Measured by its binding ability in a functional ELISA.Immobilized Human TNFRSF25 at 2 μg/mL can bind Human TNFSF15 (CSB-MP023992HU1c9) . The EC50 is 13.26-15.80 ng/mL.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Gray A.M. Genome Res. 13:2265-2270 (2003)

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.