Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 17 (Ccl17) (Active)

Product Specifications

Product Name Alternative

C-C motif chemokine 17; ABCD-2; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; Ccl17; Tarc

Abbreviation

Recombinant Mouse Ccl17 protein (Active)

Gene Name

Ccl17

UniProt

Q9WUZ6

Expression Region

24-93aa

Organism

Mus musculus (Mouse)

Target Sequence

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Tag

C-terminal mFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Chemokine, which displays chemotactic activity for T lymphocytes, preferentially Th2 cells, but not monocytes or granulocytes. Therefore plays an important role in a wide range of inflammatory and immunological processes. Acts by binding to CCR4 at T-cell surface. Mediates GM-CSF/CSF2-driven pain and inflammation. In the brain, required to maintain the typical, highly branched morphology of hippocampal microglia under homeostatic conditions. May be important for the appropriate adaptation of microglial morphology and synaptic plasticity to acute lipopolysaccharide (LPS) -induced neuroinflammation. Plays a role in wound healing, mainly by inducing fibroblast migration into the wound.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/mL can bind Mouse Ccl17 protein. The EC50 is 0.9792-1.486 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.3 kDa

References & Citations

Lineage-specific biology revealed by a finished genome assembly of the mouse. Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., Ponting C.P. PLoS Biol. 7:E1000112-E1000112 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin-5 (hIL-5) Kit
SH2403 100 Tests/Kit

Human Interleukin-5 (hIL-5) Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD31/PECAM-1 Antibody (JC/70A) [DyLight 550]
NB600-562R 0.1 mL

Mouse Monoclonal CD31/PECAM-1 Antibody (JC/70A) [DyLight 550]

Sign In for Pricing
View Details
TCEAL1 (NM_004780) Human Tagged ORF Clone
RG219873 10 µg

TCEAL1 (NM_004780) Human Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral human LONP2 shRNA (UAS) - Lentiviral human LONP2 shRNA (UAS, RFP) (25)
GTR15307958 1 Vial

Lentiviral human LONP2 shRNA (UAS) - Lentiviral human LONP2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Ribonuclease P (RNASEP)
152097 200 µL

Ribonuclease P (RNASEP)

Sign In for Pricing
View Details
Bsn sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3829503 1.0 µg DNA

Bsn sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details