Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse C-C motif chemokine 17 (Ccl17) (Active)

Product Specifications

Product Name Alternative

C-C motif chemokine 17; ABCD-2; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; Ccl17; Tarc

Abbreviation

Recombinant Mouse Ccl17 protein (Active)

Gene Name

Ccl17

UniProt

Q9WUZ6

Expression Region

24-93aa

Organism

Mus musculus (Mouse)

Target Sequence

ARATNVGRECCLDYFKGAIPIRKLVSWYKTSVECSRDAIVFLTVQGKLICADPKDKHVKKAIRLVKNPRP

Tag

C-terminal mFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Chemokine, which displays chemotactic activity for T lymphocytes, preferentially Th2 cells, but not monocytes or granulocytes. Therefore plays an important role in a wide range of inflammatory and immunological processes. Acts by binding to CCR4 at T-cell surface. Mediates GM-CSF/CSF2-driven pain and inflammation. In the brain, required to maintain the typical, highly branched morphology of hippocampal microglia under homeostatic conditions. May be important for the appropriate adaptation of microglial morphology and synaptic plasticity to acute lipopolysaccharide (LPS) -induced neuroinflammation. Plays a role in wound healing, mainly by inducing fibroblast migration into the wound.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/mL can bind Mouse Ccl17 protein. The EC50 is 0.9792-1.486 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.3 kDa

References & Citations

Lineage-specific biology revealed by a finished genome assembly of the mouse. Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., Ponting C.P. PLoS Biol. 7:E1000112-E1000112 (2009)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD154 / CD40L (113-261, His-tag) Human Protein
AR09957PU-N 100 µg

CD154 / CD40L (113-261, His-tag) Human Protein

Sign In for Pricing
View Details
SLCO2A1 ORF Vector (Human) (pORF)
44330011 1.0 µg DNA

SLCO2A1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
H2-Q3 Mouse siRNA Oligo Duplex (Locus ID 625285)
SR406363 1 Kit

H2-Q3 Mouse siRNA Oligo Duplex (Locus ID 625285)

Sign In for Pricing
View Details
Lentiviral mouse Inpp4b shRNA (UAS) - Lentiviral mouse Inpp4b shRNA (UAS) plasmid
GTR15127867 1 Vial

Lentiviral mouse Inpp4b shRNA (UAS) - Lentiviral mouse Inpp4b shRNA (UAS) plasmid

Sign In for Pricing
View Details
Mouse Monoclonal CENPQ Antibody (OTI1C5) [DyLight 550]
NBP2-71991R 0.1 mL

Mouse Monoclonal CENPQ Antibody (OTI1C5) [DyLight 550]

Sign In for Pricing
View Details
Human PWWP domain-containing protein MUM1 (MUM1) ELISA Kit
RK07728 96 Tests

Human PWWP domain-containing protein MUM1 (MUM1) ELISA Kit

Sign In for Pricing
View Details