Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta C-C motif chemokine 17 (CCL17) (Active)

Product Specifications

Product Name Alternative

C-C motif chemokine 17; CC chemokine TARC; Small-inducible cytokine A17; Thymus and activation-regulated chemokine; CCL17; TARC

Abbreviation

Recombinant Rhesus macaque CCL17 protein (Active)

Gene Name

CCL17

UniProt

Q8HYP9

Expression Region

24-94aa

Organism

Macaca mulatta (Rhesus macaque)

Target Sequence

ARGTNVGRECCLKYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQNKAICSDPNDKKVKKALKYLQSLERS

Tag

C-terminal mFc-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Chemokine, which displays chemotactic activity for T lymphocytes, preferentially Th2 cells, but not monocytes or granulocytes. Therefore plays an important role in a wide range of inflammatory and immunological processes. Acts by binding to CCR4 at T-cell surface. Mediates GM-CSF/CSF2-driven pain and inflammation. In the brain, required to maintain the typical, highly branched morphology of hippocampal microglia under homeostatic conditions. May be important for the appropriate adaptation of microglial morphology and synaptic plasticity to acute lipopolysaccharide (LPS) -induced neuroinflammation. Plays a role in wound healing, mainly by inducing fibroblast migration into the wound.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Anti-CCL17 recombinant antibody (CSB-RA856406MA1HU) at 2 μg/mL can bind Macaca mulatta CCL17 protein. The EC50 is 1.953-2.469 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.4 kDa

References & Citations

Molecular cloning and sequencing of 25 different rhesus macaque chemokine cDNAs reveals evolutionary conservation among C, CC, CXC, and CX3C families of chemokines. Basu S., Schaefer T.M., Ghosh M., Fuller C.L., Reinhart T.A. Cytokine 18:140-148 (2002)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC anti-human CD339 (Jagged 1)
GT16819 25 Tests

APC anti-human CD339 (Jagged 1)

Sign In for Pricing
View Details
P55G Antibody
C45386-01 50 μL

P55G Antibody

Sign In for Pricing
View Details
P55G Antibody
C45386-02 100 µL

P55G Antibody

Sign In for Pricing
View Details
RASL10B Antibody (Biotin)
abx309630-01 20 µg

RASL10B Antibody (Biotin)

Sign In for Pricing
View Details
RASL10B Antibody (Biotin)
abx309630-02 50 µg

RASL10B Antibody (Biotin)

Sign In for Pricing
View Details
RASL10B Antibody (Biotin)
abx309630-03 100 µg

RASL10B Antibody (Biotin)

Sign In for Pricing
View Details