Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Activin receptor type-1B (ACVR1B), partial

Product Specifications

Product Name Alternative

Activin receptor type IB; ACTR-IB; Activin receptor-like kinase 4; ALK-4; Serine/threonine-protein kinase receptor R2; SKR2

Abbreviation

Recombinant Human ACVR1B protein, partial

Gene Name

ACVR1B

UniProt

P36896

Expression Region

24-126aa

Organism

Homo sapiens (Human)

Target Sequence

SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Transmembrane serine/threonine kinase activin type-1 receptor forming an activin receptor complex with activin receptor type-2 (ACVR2A or ACVR2B) . Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating a many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, type-2 receptors (ACVR2A and/or ACVR2B) act as a primary activin receptors whereas the type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor such as ACVR1B. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor. ACVR1B also phosphorylates TDP2.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Dog Clusterin-like protein 1 (CLUL1)
MBS1479520-01 0.02 mg (E-Coli)

Recombinant Dog Clusterin-like protein 1 (CLUL1)

Ask
View Details
Recombinant Dog Clusterin-like protein 1 (CLUL1)
MBS1479520-02 0.02 mg (Yeast)

Recombinant Dog Clusterin-like protein 1 (CLUL1)

Ask
View Details
Recombinant Dog Clusterin-like protein 1 (CLUL1)
MBS1479520-03 0.1 mg (E-Coli)

Recombinant Dog Clusterin-like protein 1 (CLUL1)

Ask
View Details
Recombinant Dog Clusterin-like protein 1 (CLUL1)
MBS1479520-04 0.1 mg (Yeast)

Recombinant Dog Clusterin-like protein 1 (CLUL1)

Ask
View Details
Recombinant Dog Clusterin-like protein 1 (CLUL1)
MBS1479520-05 0.02 mg (Baculovirus)

Recombinant Dog Clusterin-like protein 1 (CLUL1)

Ask
View Details
Recombinant Dog Clusterin-like protein 1 (CLUL1)
MBS1479520-06 0.02 mg (Mammalian-Cell)

Recombinant Dog Clusterin-like protein 1 (CLUL1)

Ask
View Details