Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 13B (TNFRSF13B), partial

Product Specifications

Product Name Alternative

Transmembrane activator and CAML interactor; CD antigen CD267

Abbreviation

Recombinant Human TNFRSF13B protein, partial

Gene Name

TNFRSF13B

UniProt

O14836

Expression Region

2-166aa

Organism

Homo sapiens (Human)

Target Sequence

SGLGRSRRGGRSRVDQEERFPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKTICNHQSQRTCAAFCRSLSCRKEQGKFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGLEHRGSEASPALPGLKLSADQVALVYST

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
BNC682216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF640R conjugate, 0.1mg/mL
BNC401045-100 1x 100 µL

CD16 (C16/1045), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL
BNC740977-500 1x 500 µL

TGF-beta (1D11.16.8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (TRP/816), CF647 conjugate, 0.1mg/mL
BNC470816-100 1x 100 µL

P53 (TRP/816), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details