Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-13 (Il13)

Product Specifications

Product Name Alternative

IL-13; T-cell activation protein P600

Abbreviation

Recombinant Mouse Il13 protein

Gene Name

Il13

UniProt

P20109

Expression Region

19-131aa

Organism

Mus musculus (Mouse)

Target Sequence

APGPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

Cytokine that plays important roles in allergic inflammation and immune response to parasite infection. Synergizes with IL2 in regulating interferon-gamma synthesis. Stimulates B-cell proliferation, and activation of eosinophils, basophils, and mast cells. Plays an important role in controlling IL33 activity by modulating the production of transmembrane and soluble forms of interleukin-1 receptor-like 1/IL1RL1. Displays the capacity to antagonize Th1-driven proinflammatory immune response and downregulates synthesis of many proinflammatory cytokines including IL1, IL6, IL10, IL12 and TNF-alpha through a mechanism that partially involves suppression of NF-kappa-B. Functions also on nonhematopoietic cells, including endothelial cells where it induces vascular cell adhesion protein 1/VCAM1, which is important in the recruitment of eosinophils. Exerts its biological effects through its receptors which comprises the IL4R chain and the IL13RA1 chain, to activate JAK1 and TYK2, leading to the activation of STAT6. Aside from IL13RA1, another receptor IL13RA2 acts as a high affinity decoy for IL13 and mediates internalization and depletion of extracellular IL13.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

13.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Interleukin 8 (IL-8) ELISA Kit
201-28-0090 96 Tests

Hamster Interleukin 8 (IL-8) ELISA Kit

Sign In for Pricing
View Details
AMCAP™ OVA mRNA
MAMC102 1 mg

AMCAP™ OVA mRNA

Sign In for Pricing
View Details
SIN3A Recombinant Antibody, HRP Conjugated
bsm-61578R-HRP-TR 20 µL

SIN3A Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Monocytes, Macrophages (Biotin)
MBS6242812-01 0.1 mL

Monocytes, Macrophages (Biotin)

Sign In for Pricing
View Details
Monocytes, Macrophages (Biotin)
MBS6242812-02 5x 0.1 mL

Monocytes, Macrophages (Biotin)

Sign In for Pricing
View Details
SUCLG1 Rabbit Polyclonal Antibody
orb668306-01 30 µL

SUCLG1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details