Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Calreticulin (CALR)

Product Specifications

Product Name Alternative

CRP55; Calregulin; Endoplasmic reticulum resident protein 60; ERp60; HACBP; grp60

Abbreviation

Recombinant Human CALR protein

Gene Name

CALR

UniProt

P27797

Expression Region

18-417aa

Organism

Homo sapiens (Human)

Target Sequence

EPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDASKPEDWDERAKIDDPTDSKPEDWDKPEHIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDPSIYAYDNFGVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDKQDEEQRLKEEEEDKKRKEEEEAEDKEDDEDKDEDEEDEEDKEEDEEEDVPGQAKDEL

Tag

N-terminal 10xHis-tagged and C-terminal Flag-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Tags & Cell Markers

Relevance

Calcium-binding chaperone that promotes folding, oligomeric assembly and quality control in the endoplasmic reticulum (ER) via the calreticulin/calnexin cycle. This lectin interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. Interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. Involved in maternal gene expression regulation. May participate in oocyte maturation via the regulation of calcium homeostasis. Present in the cortical granules of non-activated oocytes, is exocytosed during the cortical reaction in response to oocyte activation and might participate in the block to polyspermy.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon: left
CS710630 5x 5 µm

Tissue FFPE Sections, Colon: left

Sign In for Pricing
View Details
2,2-Difluoro-1,3-benzodioxole
TRC-D445565-5G 5 g

2,2-Difluoro-1,3-benzodioxole

Sign In for Pricing
View Details
Mouse Sox12 activation kit by CRISPRa
GA204028 1 Kit

Mouse Sox12 activation kit by CRISPRa

Sign In for Pricing
View Details
Stability Test Chamber BTST-1501
BTST-1501 1 Unit

Stability Test Chamber BTST-1501

Sign In for Pricing
View Details
Accuris™ Precision Balance, 5000 grams, readability 0.01grams, 230V
W3200-5K-E 1 Each

Accuris™ Precision Balance, 5000 grams, readability 0.01grams, 230V

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (rSOX9/2288), CF568 conjugate, 0.1mg/mL
BNC682288-100 1x 100 µL

SOX9 / SRY-box 9 (rSOX9/2288), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details