Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Japanese encephalitis virus Envelope protein (E), partial

Product Specifications

Abbreviation

Recombinant Japanese encephalitis virus E protein, partial

Gene Name

E

UniProt

A1XJE8

Expression Region

301-398aa

Organism

Japanese encephalitis virus

Target Sequence

YGMCTEKFSFAKNPADTGHGTVVIELTYSGSDGPCKIPIVSVASLNDMTPVGRLVTVNPFVATSSSNSKVLVEMEPPFGDSYIVVGRGDKQINHHWHK

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Pepsin A Antibody
YLD6047-01 50 µL

Rabbit anti-Pepsin A Antibody

Sign In for Pricing
View Details
Rabbit anti-Pepsin A Antibody
YLD6047-02 100 µL

Rabbit anti-Pepsin A Antibody

Sign In for Pricing
View Details
Lentiviral mouse Gsta3 shRNA (UAS) - Lentiviral mouseGsta3 shRNA (UAS, GFP) (25)
GTR15303239 1 Vial

Lentiviral mouse Gsta3 shRNA (UAS) - Lentiviral mouseGsta3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-D IgG+IgM - 1 vial x 10ml, 200 tests
101660010 1 Set

Anti-D IgG+IgM - 1 vial x 10ml, 200 tests

Sign In for Pricing
View Details
Histone H1.4 (Acetyl K53) Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-0931R-PerCP-Cy5.5 100 µL

Histone H1.4 (Acetyl K53) Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
Lentiviral human NDUFS5 shRNA (UAS) - Lentiviral human NDUFS5 shRNA (UAS) plasmid
GTR15130159 1 Vial

Lentiviral human NDUFS5 shRNA (UAS) - Lentiviral human NDUFS5 shRNA (UAS) plasmid

Sign In for Pricing
View Details