Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human R-spondin-1 (RSPO1)

Product Specifications

Product Name Alternative

Roof plate-specific spondin-1; hRspo1

Abbreviation

Recombinant Human RSPO1 protein

Gene Name

RSPO1

UniProt

Q2MKA7

Expression Region

21-263aa

Organism

Homo sapiens (Human)

Target Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Developmental Biology

Relevance

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway. Acts as a ligand for frizzled FZD8 and LRP6. May negatively regulate the TGF-beta pathway. Has a essential roles in ovary determination. Regulates Wnt signaling by antagonizing DKK1/KREM1-mediated internalization of LRP6 through an interaction with KREM1.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

28.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neurofilament (NEFM) Human Gene Knockout Kit (CRISPR)
KN424475 1 Kit

Neurofilament (NEFM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1'N-Benzyl Biotin and 3'N-Benzyl Biotin (mixture of regioisomers)
TRC-B233026-5MG 5 mg

1'N-Benzyl Biotin and 3'N-Benzyl Biotin (mixture of regioisomers)

Sign In for Pricing
View Details
3,5-Dinitro-4-chloropyridine
TRC-D479770-1G 1 g

3,5-Dinitro-4-chloropyridine

Sign In for Pricing
View Details
XPF (ERCC4) (NM_005236) Human Over-expression Lysate
LC401605 20 µg

XPF (ERCC4) (NM_005236) Human Over-expression Lysate

Sign In for Pricing
View Details
UBE2W Rabbit Polyclonal Antibody
TA369774 100 µL

UBE2W Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MAmL1 (NM_014757) Human Recombinant Protein
TP314790 20 µg

MAmL1 (NM_014757) Human Recombinant Protein

Sign In for Pricing
View Details