Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Mas-related G-protein coupled receptor member X2 (Mrgprx2) -VLPs

Product Specifications

Product Name Alternative

Mas-related G-protein coupled receptor member B10

Abbreviation

Recombinant Mouse Mrgprx2 protein-VLPs

Gene Name

Mrgprx2

UniProt

Q3UG50

Expression Region

1-352aa

Organism

Mus musculus (Mouse)

Target Sequence

MEERNISGRDLRVDSNITYWGTNITAVNESNHTGMSFCEVVSCTMVFLSLIVALVGLVGNATVLWFLGFQMRRNAFSVYILNLAGADFLFICFQIGYCFHMILDIDSIPIEIDLFYLVVLNFPYFCGLSILSAISIERCLSVMWPIWYHCQRPRHTSAVICTLLWVLSLVCSLLEGKECGFLYYTSDPGWCKTFDLITATWLIVLFVALLGSSLALVITIFWGLHKIPVTRLYVAIVFTVLVFLLFGLPYGIYWFLLVWIEKFYYVLPCSIYPVTVFLSCVNSSAKPIIYCLVGSIRHHRFQRKTLKLFLQRAMQDTPEEEECGEMGSSGRSREIKTIWKGLRAALIRHKEL

Tag

C-terminal 10xHis-tagged

Type

MP-VLP Transmembrane Protein & Developed Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain.

Endotoxin

Not test

Purity

The purity information is not available for VLPs proteins.

Activity

Not Test

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL
BNC430151-500 1x 500 µL

CD11a (Cris-3), CF543 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF740 conjugate, 0.1mg/mL
BNC740645-100 1x 100 µL

FOXP3 (3G3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
BNC880994-100 1x 100 µL

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF405S conjugate, 0.1mg/mL
BNC041366-500 1x 500 µL

Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details