Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mucin-13 (MUC13), partial

Product Specifications

Product Name Alternative

MUC-13; Down-regulated in colon cancer 1

Abbreviation

Recombinant Human MUC13 protein, partial

Gene Name

MUC13

UniProt

Q9H3R2

Expression Region

322-421aa

Organism

Homo sapiens (Human)

Target Sequence

LTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFCVASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQL

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Epithelial and hemopoietic transmembrane mucin that may play a role in cell signaling.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS630709 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Human C1orf223 (TEX38) activation kit by CRISPRa
GA117798 1 Kit

Human C1orf223 (TEX38) activation kit by CRISPRa

Sign In for Pricing
View Details
FUT3 (NM_000149) Human Over-expression Lysate
LC424899 20 µg

FUT3 (NM_000149) Human Over-expression Lysate

Sign In for Pricing
View Details
Human WAP Four Disulfide Core Domain Protein 2 (WFDC2) ELISA Kit
RDR-WFDC2-Hu-01 96 Tests

Human WAP Four Disulfide Core Domain Protein 2 (WFDC2) ELISA Kit

Sign In for Pricing
View Details
Human WAP Four Disulfide Core Domain Protein 2 (WFDC2) ELISA Kit
RDR-WFDC2-Hu-02 48 Tests

Human WAP Four Disulfide Core Domain Protein 2 (WFDC2) ELISA Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS707640 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details