Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis CD93 molecule (CD93), partial

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey CD93 protein, partial

Gene Name

CD93

UniProt

A0A2K5VH53

Expression Region

24-581aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

ADTEAVVCAGTACYTAHWGKLSAAEAQNLCLQNGGNLATVKSEEEAQHVQQVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPGRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDDSQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCIPGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGSFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTEGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFRCGCLPGWVLAPNGVSCAMGPVSLGPPSGPPDEEYKGEREGSTVPPAATASPTRGPEGTPKSTPTTRRPLLSSDAPITSVPLEVLAPSGSPGLWREPSIHHTTAASGAQEPAGGDSSVATQNDDGTDGQKL

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Other

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

87.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial
MBS1372091-01 0.05 mg (E-Coli)

Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial
MBS1372091-02 0.05 mg (Baculovirus)

Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial
MBS1372091-03 0.2 mg (E-Coli)

Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial
MBS1372091-04 0.2 mg (Yeast)

Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial
MBS1372091-05 0.5 mg (E-Coli)

Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial
MBS1372091-06 0.05 mg (Mammalian-Cell)

Recombinant Salmonella paratyphi A Ribose import ATP-binding protein RbsA (rbsA), partial

Sign In for Pricing
View Details