Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Tumor necrosis factor receptor superfamily member 13B, partial (Active)

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 13B; Transmembrane activator and CAML interactor; EGM_07468

Abbreviation

Recombinant Cynomolgus monkey TNFRSF13B protein, partial (Active)

Gene Name

TNFRSF13B

UniProt

G7PTR7

Expression Region

2-160aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

SGLGRSRRGGRSRVDQEERSPQGLWTGVAMRSCPEEQYWDPLLGTCMSCKAICNHQSQRTCATFCRSLNCRKEQGRFYDHLLRDCISCASICGQHPKQCAYFCENKLRSPVNLPPELRRQRSGEVENNSDNSGRYQGSEHRGSEASPALPGLKLSADQL

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for TNFSF13/APRIL and TNFSF13B/TALL1/BAFF/BLYS that binds both ligands with similar high affinity. Mediates calcineurin-dependent activation of NF-AT, as well as activation of NF-kappa-B and AP-1. Involved in the stimulation of B- and T-cell function and the regulation of humoral immunity.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

①Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Macaca fascicularis TNFSF13B protein (CSB-MP6724MOV) . The EC50 is 7.254-13.83 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13 protein (CSB-MP023989HU) . The EC50 is 11.13-18.97 ng/mL. ③Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1) . The EC50 is 10.67-12.46 ng/mL. ④Measured by its binding ability in a functional ELISA. Immobilized Macaca fascicularis TNFRSF13B at 2 μg/mL can bind Human TNFSF13B protein (CSB-MP897523HU1-B) . The EC50 is 0.6374-1.431 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

19.2 kDa

References & Citations

Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques. Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., Wang J. Nat. Biotechnol. 29:1019-1023 (2011)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF594 conjugate, 0.1mg/mL
BNC940176-500 1x 500 µL

CD5 (Cris-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL
BNC040842-500 1x 500 µL

MUC2 (MLP/842), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL
BNC471199-500 1x 500 µL

SUMO-2 (SUMO2/1199), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (ICAM3/1019), CF405S conjugate, 0.1mg/mL
BNC041019-500 1x 500 µL

CD50 (ICAM-3) (ICAM3/1019), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details