Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 8 (MSTN)

Product Specifications

Product Name Alternative

GDF-8; Myostatin

Abbreviation

Recombinant Human MSTN protein

Gene Name

MSTN

UniProt

O14793

Expression Region

267-375aa

Organism

Homo sapiens (Human)

Target Sequence

DFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Acts specifically as a negative regulator of skeletal muscle growth.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Ctsg/Cathepsin G ELISA Kit
orb1661609 96 Tests

Mouse Ctsg/Cathepsin G ELISA Kit

Sign In for Pricing
View Details
Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit
CK-bio-14469-01 48 Tests

Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit

Sign In for Pricing
View Details
Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit
CK-bio-14469-02 96 Tests

Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit

Sign In for Pricing
View Details
Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit
CK-bio-14469-03 5x 96 Tests

Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit

Sign In for Pricing
View Details
Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit
CK-bio-14469-04 10x 96 Tests

Rat CXC-chemokine receptor 4, CXCR4 ELISA Kit

Sign In for Pricing
View Details
Cyclosporin A-D4 Acetate
CS-F-00079 1 Each

Cyclosporin A-D4 Acetate

Sign In for Pricing
View Details