Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B), partial (Active)

Product Specifications

Product Name Alternative

Tumor necrosis factor receptor superfamily member 10B; Death receptor 5; TNF-related apoptosis-inducing ligand receptor 2 (TRAIL receptor 2; TRAIL-R2) ; CD262; TNFRSF10B; DR5, KILLER, TRAILR2, TRICK2, ZTNFR9; UNQ160/PRO186

Abbreviation

Recombinant Human TNFRSF10B protein, partial (Active)

Gene Name

TNFRSF10B

UniProt

O14763

Expression Region

56-182aa

Organism

Homo sapiens (Human)

Target Sequence

ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKE

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TNFRSF10B at 2 μg/mL can bind Anti-TNFRSF10B recombinant antibody (CSB-RA023965MA2HU) . The EC50 is 1.880-2.195 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

15.7 kDa

References & Citations

The full-ORF clone resource of the German cDNA consortium. Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Schupp I. BMC Genomics 8:399-399 (2007)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit
MBS008437-01 48 Well

Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit

Ask
View Details
Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit
MBS008437-02 96 Well

Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit

Ask
View Details
Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit
MBS008437-03 5x 96 Well

Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit

Ask
View Details
Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit
MBS008437-04 10x 96 Well

Sheep Cross-Linked C-Terminal Telopeptides of Type II Collagen ELISA Kit

Ask
View Details
FABP2 (Fatty Acid-binding Protein, Intestinal, Fatty Acid-binding Protein 2, Intestinal-type Fatty Acid-binding Protein, I-FABP, FABPI) (MaxLight 650)
126548-ML650 100 µL

FABP2 (Fatty Acid-binding Protein, Intestinal, Fatty Acid-binding Protein 2, Intestinal-type Fatty Acid-binding Protein, I-FABP, FABPI) (MaxLight 650)

Ask
View Details
NOLC1 (KIAA0035, Nucleolar and Coiled-Body Phosphoprotein 1, Nucleolar Phosphoprotein p130, Nucleolar 130kD Protein, 140kD Nucleolar Phosphoprotein, Nopp140, Hepatitis C Virus NS5A-Transactivated Protein 13, HCV NS5A-Transactivated Protein 13, NS5ATP13) (HRP)
130465-HRP 100 µL

NOLC1 (KIAA0035, Nucleolar and Coiled-Body Phosphoprotein 1, Nucleolar Phosphoprotein p130, Nucleolar 130kD Protein, 140kD Nucleolar Phosphoprotein, Nopp140, Hepatitis C Virus NS5A-Transactivated Protein 13, HCV NS5A-Transactivated Protein 13, NS5ATP13) (HRP)

Ask
View Details