Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human 72 kDa type IV collagenase (MMP2)

Product Specifications

Product Name Alternative

72 kDa gelatinase; Gelatinase A; Matrix metalloproteinase-2 (MMP-2) ; TBE-1

Abbreviation

Recombinant Human MMP2 protein

Gene Name

MMP2

UniProt

P08253

Expression Region

30-660aa

Organism

Homo sapiens (Human)

Target Sequence

APSPIIKFPGDVAPKTDKELAVQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQPCKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICKQDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWLGC

Tag

C-terminal 10xHis-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Cancer

Relevance

Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

72.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL-4 (Interleukin-4), Mouse (11B11), CF488A conjugate, 0.1mg/mL
BNC882008-100 1x 100 µL

IL-4 (Interleukin-4), Mouse (11B11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AR Rabbit Monoclonal Antibody [Clone ID: 23GB3210]
TA424506 100 µL

AR Rabbit Monoclonal Antibody [Clone ID: 23GB3210]

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-01 60 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-02 120 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details
TPD52L3 Polyclonal Antibody
E-AB-65358-03 200 µL

TPD52L3 Polyclonal Antibody

Sign In for Pricing
View Details
Ramp2 (NM_019444) Mouse Tagged ORF Clone
MG201796 10 µg

Ramp2 (NM_019444) Mouse Tagged ORF Clone

Sign In for Pricing
View Details