Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium intracellulare Lipoprotein LpqH (lpqH)

Product Specifications

Product Name Alternative

19 kDa lipoprotein antigen;22 kDa lipoprotein antigen; Mi22 antigen; Putative transporter LpqH

Abbreviation

Recombinant Mycobacterium intracellulare lpqH protein

Gene Name

LpqH

UniProt

P31502

Expression Region

22-162aa

Organism

Mycobacterium intracellulare

Target Sequence

CSGGNKSGTSASSSANSSGTTRRLAPGAAGTKVTIDGKDQNVSGSVVCTNAGGTINIAIGGAATGIAAVLSDGNPPQVKSVGLGNVNGVTLGYTSGTGQGNATASKDGNSYKISGTATGVDMANPMQPVNKPFEINVTCNS

Tag

C-terminal hFc1-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Might be involved in ligand transport. A host TLR2 agonist, modifies host gene expression in response to pathogen.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

42.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF640R conjugate, 0.1mg/mL
BNC400152-100 1x 100 µL

CD11c (HC1/1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL
BNC680429-500 1x 500 µL

CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF405S conjugate, 0.1mg/mL
BNC042222-500 1x 500 µL

Human Kappa Light Chain (B-Cell Marker) (rL1C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF740 conjugate, 0.1mg/mL
BNC742085-100 1x 100 µL

TLE1 (Synovial Sarcoma Marker) (TLE1/2085), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF640R conjugate, 0.1mg/mL
BNC401975-500 1x 500 µL

CD45 / LCA (B-Cell Marker) (PTPRC/1975R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details