Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Receptor activity-modifying protein 3 (Ramp3), partial

Product Specifications

Product Name Alternative

Ramp3

Abbreviation

Recombinant Mouse Ramp3 protein, partial

Gene Name

Ramp3

UniProt

Q9WUP1

Expression Region

23-117aa

Organism

Mus musculus (Mouse)

Target Sequence

QVCGCNETGMLERLPRCGKAFADMMQKVAVWKWCNLSEFIVYYESFTNCTEMETNIMGCYWPNPLAQSFITGIHRQFFSNCTVDRTHWEDPPDEV

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Accessory protein that interacts with and modulates the function of G-protein coupled receptors including calcitonin gene-related peptide type 1 receptor (CALCRL), calcitonin receptor (CALCR) and G-protein coupled estrogen receptor 1 (GPER1) (PubMed:10854696, PubMed:23674134) . Required for the transport of CALCRL and GPER1 receptors to the plasma membrane (By similarity) . Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner (PubMed:23674134) . Together with CALCRL, form a receptor complex for adrenomedullin/ADM and intermedin/ADM2 (PubMed:10854696) . Together with CALCR, act as a receptor complex for amylin/IAPP (By similarity) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHRS9 Polyclonal Antibody
A53477-100 100 µL

DHRS9 Polyclonal Antibody

Sign In for Pricing
View Details
Rat IgG2a, kappa Isotype Control (PE/Cy7 Conjugated)
MBS2557859-01 0.025 mg

Rat IgG2a, kappa Isotype Control (PE/Cy7 Conjugated)

Sign In for Pricing
View Details
Rat IgG2a, kappa Isotype Control (PE/Cy7 Conjugated)
MBS2557859-02 0.1 mg

Rat IgG2a, kappa Isotype Control (PE/Cy7 Conjugated)

Sign In for Pricing
View Details
Rat IgG2a, kappa Isotype Control (PE/Cy7 Conjugated)
MBS2557859-03 5x 0.1 mg

Rat IgG2a, kappa Isotype Control (PE/Cy7 Conjugated)

Sign In for Pricing
View Details
1700080E11Rik (NM_028562) Mouse Tagged ORF Clone Lentiviral Particle
MR214675L4V 200 µL

1700080E11Rik (NM_028562) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ALX3 Double Nickase Plasmid (m)
sc-419094-NIC 20 µg

ALX3 Double Nickase Plasmid (m)

Sign In for Pricing
View Details