Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Synaptogyrin-2 (SYNGR2), partial

Product Specifications

Product Name Alternative

Cellugyrin

Abbreviation

Recombinant Human SYNGR2 protein, partial

Gene Name

SYNGR2

UniProt

O43760

Expression Region

168-224aa

Organism

Homo sapiens (Human)

Target Sequence

QRYKAGVDDFIQNYVDPTPDPNTAYASYPGASVDNYQQPPFTQNAETTEGYQPPPVY

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

May play a role in regulated exocytosis. In neuronal cells, modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in the formation and/or the maturation of this vesicles. May also play a role in GLUT4 storage and transport to the plasma membrane. ; (Microbial infection) May play a role in the assembly of cytoplasmic inclusion bodies required for SFTS phlebovirus replication.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

8.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS511094 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
ARPC5L Rabbit pAb (APR22493N)
APR22493N-01 50 µL

ARPC5L Rabbit pAb (APR22493N)

Sign In for Pricing
View Details
ARPC5L Rabbit pAb (APR22493N)
APR22493N-02 100 µL

ARPC5L Rabbit pAb (APR22493N)

Sign In for Pricing
View Details
ARPC5L Rabbit pAb (APR22493N)
APR22493N-03 200 µL

ARPC5L Rabbit pAb (APR22493N)

Sign In for Pricing
View Details
Mouse Monoclonal Creatine Kinase BB Antibody (2ba6) [HRP]
NBP2-59601H 0.1 mL

Mouse Monoclonal Creatine Kinase BB Antibody (2ba6) [HRP]

Sign In for Pricing
View Details
C19orf25 Rabbit Polyclonal Antibody (BF488)
orb2521382 100 µL

C19orf25 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details