Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Enamelin (ENAM), partial

Product Specifications

Abbreviation

Recombinant Human ENAM protein, partial

Gene Name

ENAM

UniProt

Q9NRM1

Expression Region

1043-1142aa

Organism

Homo sapiens (Human)

Target Sequence

ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Involved in the mineralization and structural organization of enamel. Involved in the extension of enamel during the secretory stage of dental enamel formation.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit
MBS1607225-01 48 Well

Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit

Sign In for Pricing
View Details
Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit
MBS1607225-02 96 Well

Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit

Sign In for Pricing
View Details
Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit
MBS1607225-03 5x 96 Well

Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit

Sign In for Pricing
View Details
Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit
MBS1607225-04 10x 96 Well

Human UDP-glucuronosyltransferase 1-6, UGT1A6 ELISA Kit

Sign In for Pricing
View Details
NFKBIB Antibody
A47632-100UL 100 µL

NFKBIB Antibody

Sign In for Pricing
View Details
Rat Prss53 Pre-designed siRNA Set A
SI211204A 1 Each

Rat Prss53 Pre-designed siRNA Set A

Sign In for Pricing
View Details