Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Enamelin (ENAM), partial

Product Specifications

Abbreviation

Recombinant Human ENAM protein, partial

Gene Name

ENAM

UniProt

Q9NRM1

Expression Region

1043-1142aa

Organism

Homo sapiens (Human)

Target Sequence

ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Involved in the mineralization and structural organization of enamel. Involved in the extension of enamel during the secretory stage of dental enamel formation.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

12.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

mGluR-2 Lentiviral Activation Particles (m2)
sc-430795-LAC-2 200 µL

mGluR-2 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)
MBS1386682-01 0.02 mg (E-Coli)

Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)
MBS1386682-02 0.02 mg (Yeast)

Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)
MBS1386682-03 0.1 mg (E-Coli)

Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)
MBS1386682-04 0.1 mg (Yeast)

Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)

Sign In for Pricing
View Details
Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)
MBS1386682-05 0.02 mg (Baculovirus)

Recombinant Staphylococcus epidermidis UPF0272 protein SERP0253 (SERP0253)

Sign In for Pricing
View Details