Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Interleukin-2 receptor subunit alpha (IL2RA), partial

Product Specifications

Product Name Alternative

IL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; IL2-RA; CD antigen CD25

Abbreviation

Recombinant Pig IL2RA protein, partial

Gene Name

IL2RA

UniProt

O02733

Expression Region

22-245aa

Organism

Sus scrofa (Pig)

Target Sequence

GACVQQPPSLRNATFKILGYKVGTTLNCDCQRGFRRDPSSGPYMICRGNSSHSFWENKCQCMPTSSPRIPVKQVTPRPEEQKERKTTETQGQMQPPNQANLPGHCKEPPPWEHESLKRVYHFMEGQTVRYQCLPGFRDGSAQNNSAQSVCKKQEDQEVMRWTQPKLKCKSEKENGSFPEPQMSTAAPPTTKTSLPTRTKGTTDSQNLTEVPATMQPIIFTTQYQ

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gimap6 Rat Pre-designed siRNA Set A
HY-RS27652 1 Set

Gimap6 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (PE)
MBS6185197-01 0.1 mL

DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (PE)

Sign In for Pricing
View Details
DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (PE)
MBS6185197-02 5x 0.1 mL

DND1 (dead end Homolog 1 (zebrafish), MGC34750, RBMS4) (PE)

Sign In for Pricing
View Details
SRRP35 (SRSF12) (NM_080743) Human Over-expression Lysate
LS135295-100ug 100 µg

SRRP35 (SRSF12) (NM_080743) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rhizobium etli Chaperone protein DnaJ (dnaJ)
MBS1338900-01 0.02 mg (E-Coli)

Recombinant Rhizobium etli Chaperone protein DnaJ (dnaJ)

Sign In for Pricing
View Details
Recombinant Rhizobium etli Chaperone protein DnaJ (dnaJ)
MBS1338900-02 0.02 mg (Yeast)

Recombinant Rhizobium etli Chaperone protein DnaJ (dnaJ)

Sign In for Pricing
View Details