Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a)

Product Specifications

Product Name Alternative

Zf-FABP10; Zf-Lb-FABP; Fatty acid-binding protein, liver; Liver bile acid-binding protein; L-BABP; z-L-BABP; Liver-type fatty acid-binding protein; L-FABP; Liver-type FABP

Abbreviation

Recombinant Zebrafish fabp10a protein

Gene Name

Fabp10a

UniProt

Q9I8L5

Expression Region

1-126aa

Organism

Danio rerio (Zebrafish) (Brachydanio rerio)

Target Sequence

MAFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVCRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKI

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Binds hydrophobic ligands, such as cholate, in the cytoplasm. May be involved in intracellular lipid transport. Binds one cholate per subunit.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCF4 (Transcription Factor 4) (TCF4/1705), 0.2mg/mL
BNUB1705-500 1x 500 µL

TCF4 (Transcription Factor 4) (TCF4/1705), 0.2mg/mL

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r2H11), Biotin conjugate, 0.1mg/mL
BNCB2161-500 1x 500 µL

Thyroglobulin (Thyroidal Cell Marker) (r2H11), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), Biotin conjugate, 0.1mg/mL
BNCB1796-500 1x 500 µL

CD22 / BL-CAM (B-Cell Marker) (BLCAM/1796), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elp3 Recombinant Rabbit Monoclonal Antibody [JE60-10]
HA720046 100 µL

Elp3 Recombinant Rabbit Monoclonal Antibody [JE60-10]

Sign In for Pricing
View Details
Calpastatin (CAST/1550), CF488A conjugate, 0.1mg/mL
BNC881550-500 1x 500 µL

Calpastatin (CAST/1550), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF647 conjugate, 0.1mg/mL
BNC471908-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details