Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Fatty acid-binding protein 10-A, liver basic (fabp10a)

Product Specifications

Product Name Alternative

Zf-FABP10; Zf-Lb-FABP; Fatty acid-binding protein, liver; Liver bile acid-binding protein; L-BABP; z-L-BABP; Liver-type fatty acid-binding protein; L-FABP; Liver-type FABP

Abbreviation

Recombinant Zebrafish fabp10a protein

Gene Name

Fabp10a

UniProt

Q9I8L5

Expression Region

1-126aa

Organism

Danio rerio (Zebrafish) (Brachydanio rerio)

Target Sequence

MAFSGTWQVYAQENYEEFLRAISLPEEVIKLAKDVKPVTEIQQNGSDFTITSKTPGKTVTNSFTIGKEAEITTMDGKKLKCIVKLDGGKLVCRTDRFSHIQEIKAGEMVETLTVGGTTMIRKSKKI

Tag

N-terminal 6xHis-sumostar-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Others

Relevance

Binds hydrophobic ligands, such as cholate, in the cytoplasm. May be involved in intracellular lipid transport. Binds one cholate per subunit.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

27.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Mouse IgG,
AA-2306-1 1 mL

Alkaline Phosphatase Conjugated Goat Polyclonal Antibody to Mouse IgG,

Sign In for Pricing
View Details
Mouse HMGB-1 (High Mobility Group Protein B1) CLIA Kit
E-CL-M0419-01 24 Tests

Mouse HMGB-1 (High Mobility Group Protein B1) CLIA Kit

Sign In for Pricing
View Details
Mouse HMGB-1 (High Mobility Group Protein B1) CLIA Kit
E-CL-M0419-02 48 Tests

Mouse HMGB-1 (High Mobility Group Protein B1) CLIA Kit

Sign In for Pricing
View Details
Mouse HMGB-1 (High Mobility Group Protein B1) CLIA Kit
E-CL-M0419-03 96 Tests

Mouse HMGB-1 (High Mobility Group Protein B1) CLIA Kit

Sign In for Pricing
View Details
Recombinant Mouse CD6/TP120 Protein (His Tag)
PKSM040529 100 µg

Recombinant Mouse CD6/TP120 Protein (His Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS806101 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details