Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tumor necrosis factor ligand superfamily member 15 (TNFSF15)

Product Specifications

Product Name Alternative

TNF ligand-related molecule 1; Vascular endothelial cell growth inhibitor

Abbreviation

Recombinant Human TNFSF15 protein

Gene Name

TNFSF15

UniProt

O95150-2

Expression Region

1-192aa

Organism

Homo sapiens (Human)

Target Sequence

MQLTKGRLHFSHPLSHTKHISPFVTDAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Tag

N-terminal 6xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro) . Promotes activation of caspases and apoptosis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Isoform 2

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat CXCR7/RDC-1 MAb (Clone 896032)
MAB8399 100 µg

Rat CXCR7/RDC-1 MAb (Clone 896032)

Sign In for Pricing
View Details
ABCD1 (ATP-binding Cassette Sub-family D Member 1, ALD, AMN, ALDP, ABC42) (HRP)
MBS6404995-01 0.1 mL

ABCD1 (ATP-binding Cassette Sub-family D Member 1, ALD, AMN, ALDP, ABC42) (HRP)

Sign In for Pricing
View Details
ABCD1 (ATP-binding Cassette Sub-family D Member 1, ALD, AMN, ALDP, ABC42) (HRP)
MBS6404995-02 5x 0.1 mL

ABCD1 (ATP-binding Cassette Sub-family D Member 1, ALD, AMN, ALDP, ABC42) (HRP)

Sign In for Pricing
View Details
RhoC, aa1-190, Recombinant, Human (Rho-related GTP-binding protein RhoC)
R1998-10R 50 µg

RhoC, aa1-190, Recombinant, Human (Rho-related GTP-binding protein RhoC)

Sign In for Pricing
View Details
MMP1 (Cleaved-Ile271) Rabbit Polyclonal Antibody
BT-AP03630-01 20 µL

MMP1 (Cleaved-Ile271) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MMP1 (Cleaved-Ile271) Rabbit Polyclonal Antibody
BT-AP03630-02 50 µL

MMP1 (Cleaved-Ile271) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details