Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Dipeptidase 2 (DPEP2)

Product Specifications

Abbreviation

Recombinant Human DPEP2 protein

Gene Name

DPEP2

UniProt

Q9H4A9

Expression Region

33-463aa

Organism

Homo sapiens (Human)

Target Sequence

AYTTPGPPRALTTLGAPRAHTMPGTYAPSTTLSSPSTQGLQEQARALMRDFPLVDGHNDLPLVLRQVYQKGLQDVNLRNFSYGQTSLDRLRDGLVGAQFWSAYVPCQTQDRDALRLTLEQIDLIRRMCASYSELELVTSAKALNDTQKLACLIGVEGGHSLDNSLSILRTFYMLGVRYLTLTHTCNTPWAESSAKGVHSFYNNISGLTDFGEKVVAEMNRLGMMVDLSHVSDAVARRALEVSQAPVIFSHSAARGVCNSARNVPDDILQLLKKNGGVVMVSLSMGVIQCNPSANVSTVADHFDHIKAVIGSKFIGIGGDYDGAGKFPQGLEDVSTYPVLIEELLSRGWSEEELQGVLRGNLLRVFRQVEKVQEENKWQSPLEDKFPDEQLSSSCHSDLSRLRQRQSLTSGQELTEIPIHWTAKLPAKWSVS

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Yeast

Field of Research

Cancer

Relevance

Dipeptidase that hydrolyzes leukotriene D4 (LTD4) into leukotriene E4 (LTE4) . Hydrolyzes cystinyl-bis-glycine. ; Independently of its dipeptidase activity can also modulate macrophage inflammatory response by acting as a regulator of NF-kappaB inflammatory signaling pathway.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

50.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Polr2b shRNA (UAS) - Lentiviral mouse Polr2b shRNA (UAS) plasmid
GTR15221479 1 Vial

Lentiviral mouse Polr2b shRNA (UAS) - Lentiviral mouse Polr2b shRNA (UAS) plasmid

Sign In for Pricing
View Details
Uap1 Peptide - C-terminal region (AAP49212)
AAP49212-100UG 100 µg

Uap1 Peptide - C-terminal region (AAP49212)

Sign In for Pricing
View Details
PPP2R3 Rabbit Polyclonal Antibody (BF555)
orb2408906 100 µL

PPP2R3 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
ZNF836 Antibody (N-term)
orb31709-01 50 µL

ZNF836 Antibody (N-term)

Sign In for Pricing
View Details
ZNF836 Antibody (N-term)
orb31709-02 100 µL

ZNF836 Antibody (N-term)

Sign In for Pricing
View Details
Mouse MMP-2(Matrix Metalloproteinase 2) ELISA Kit
SYP-M0205-01 48 Well

Mouse MMP-2(Matrix Metalloproteinase 2) ELISA Kit

Sign In for Pricing
View Details